Lineage for d3qehe_ (3qeh E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756376Domain d3qehe_: 3qeh E: [408614]
    Other proteins in same PDB: d3qehb2, d3qehd2, d3qehf2, d3qehh2
    automated match to d6shgh_
    complexed with cl, gol, so4

Details for d3qehe_

PDB Entry: 3qeh (more details), 2.59 Å

PDB Description: Crystal structure of human N12-i15, an ADCC and non-neutralizing anti-HIV-1 Env antibody
PDB Compounds: (E:) Fab fragment of human anti-HIV-1 Env antibody N12-i15, heavy chain

SCOPe Domain Sequences for d3qehe_:

Sequence, based on SEQRES records: (download)

>d3qehe_ b.1.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevrkpgasvtvscktsgytfvnfyivwvrqapgqglewmgvinpfrgdtyf
aqkfkgrvtltrdtststvfmelsslrsddtaiyycardlemrdgnnhgshlefwgqgtl
vtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpa
vlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrve

Sequence, based on observed residues (ATOM records): (download)

>d3qehe_ b.1.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevrkpgasvtvscktsgytfvnfyivwvrqapgqglewmgvinpfrgdtyf
aqkfkgrvtltrdtststvfmelsslrsddtaiyycardlemrdgnnhgshlefwgqgtl
vtvssastkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslqtyicnvnhkpsntkvdkrve

SCOPe Domain Coordinates for d3qehe_:

Click to download the PDB-style file with coordinates for d3qehe_.
(The format of our PDB-style files is described here.)

Timeline for d3qehe_:

  • d3qehe_ is new in SCOPe 2.08-stable