Lineage for d3q1sh_ (3q1s H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755187Domain d3q1sh_: 3q1s H: [408587]
    Other proteins in same PDB: d3q1si_
    automated match to d6shgh_
    complexed with gol, ipa

Details for d3q1sh_

PDB Entry: 3q1s (more details), 2.15 Å

PDB Description: HIV-1 neutralizing antibody Z13e1 in complex with epitope display protein
PDB Compounds: (H:) Z13e1 Fab heavy chain

SCOPe Domain Sequences for d3q1sh_:

Sequence, based on SEQRES records: (download)

>d3q1sh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesgpgllkpsetlsltctvsggsminyywswirqppgerpqwlghiiyggttkyn
pslesritisrdisknqfslrlnsvtaadtaiyycarvaigvsgflnyyyymdvwgsgta
vtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpa
vlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d3q1sh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesgpgllkpsetlsltctvsggsminyywswirqppgerpqwlghiiyggttkyn
pslesritisrdisknqfslrlnsvtaadtaiyycarvaigvsgflnyyyymdvwgsgta
vtvssastkgpsvfplatsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvttyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d3q1sh_:

Click to download the PDB-style file with coordinates for d3q1sh_.
(The format of our PDB-style files is described here.)

Timeline for d3q1sh_:

  • d3q1sh_ is new in SCOPe 2.08-stable