SCOPe 2.08: Domain d3oz9h1: 3oz9 H:9-228

Lineage for d3oz9h1 (3oz9 H:9-228)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d3oz9h1: 3oz9 H:9-228 [408576]
   Other proteins in same PDB: d3oz9h2, d3oz9l1, d3oz9l2
   automated match to d6shgh_
   complexed with gol

Details for d3oz9h1

PDB Entry: 3oz9, 1.6 Å

PDB Description: crystal structure of anti-gp41 fab nc-1

PDB Compounds: (H:) Fab NC-1 IgG2a heavy chain

SCOPe Domain Sequences for d3oz9h1:

Sequence; same for both SEQRES and ATOM records:

>d3oz9h1 b.1.1.1 (H:9-228) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
telmkpgssvkisckatgyrfssywvewvkqrpghglewigkilpgigstsynekfkgka
tftadtssntaymqlssltsedsavyycargyygptwfaywgqgtlvtvssakttapsvy
plapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvt
vtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d3oz9h1:

• d3oz9h1 is new in SCOPe 2.08-stable