SCOPe 2.08: Domain d3o11h1: 3o11 H:1-222

Lineage for d3o11h1 (3o11 H:1-222)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3o11h1: 3o11 H:1-222 [408558]
   Other proteins in same PDB: d3o11a2, d3o11b2, d3o11h2, d3o11l2
   automated match to d6shgh_

Details for d3o11h1

PDB Entry: 3o11, 2.8 Å

PDB Description: anti-beta-amyloid antibody c706 fab in space group c2

PDB Compounds: (H:) C706 HEAVY CHAIN variable region, Ig gamma-1 chain C region chimera

SCOPe Domain Sequences for d3o11h1:

Sequence, based on SEQRES records:

>d3o11h1 b.1.1.0 (H:1-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlqqsgpelmkpgasvkisckatgytfstswiewikqrpghglewigevlpgsgksnh
nanfkgratftadtasntaymqlssltsedsavyycaregsnnnalaywgqgtlvtvsaa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records):

>d3o11h1 b.1.1.0 (H:1-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlqqsgpelmkpgasvkisckatgytfstswiewikqrpghglewigevlpgsgksnh
nanfkgratftadtasntaymqlssltsedsavyycaregsnnnalaywgqgtlvtvsaa
stkgpsvfplapsstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d3o11h1:

• d3o11h1 is new in SCOPe 2.08-stable