Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
Protein automated matches [191113] (13 species) not a true protein |
Species Clostridium cellulovorans [TaxId:1493] [419862] (2 PDB entries) |
Domain d3ndzh_: 3ndz H: [408531] Other proteins in same PDB: d3ndza_, d3ndzb_, d3ndzc_, d3ndzd_ automated match to d6qfsa_ |
PDB Entry: 3ndz (more details), 2.08 Å
SCOPe Domain Sequences for d3ndzh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ndzh_ b.2.2.0 (H:) automated matches {Clostridium cellulovorans [TaxId: 1493]} savevtyaitnswgsgasvnvtiknngttpingwtlkwtmpinqtitnmwsasfvasgtt lsvtnagyngtiaanggtqsfgfninysgvlskptgftvngtectvk
Timeline for d3ndzh_: