SCOPe 2.08: Domain d3nach1: 3nac H:1-210

Lineage for d3nach1 (3nac H:1-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3nach1: 3nac H:1-210 [408520]
   Other proteins in same PDB: d3nach2, d3nacl2
   automated match to d6shgh_
   complexed with act, gol, zn

Details for d3nach1

PDB Entry: 3nac, 1.8 Å

PDB Description: crystal structure of fab15 mut7

PDB Compounds: (H:) Fab15 Mut7 heavy chain

SCOPe Domain Sequences for d3nach1:

Sequence; same for both SEQRES and ATOM records:

>d3nach1 b.1.1.0 (H:1-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgeslkisckgsgysftnywiswvrqmpgkglewmgridpsdsytny
spsfqghvtisadksistaylqwsslkasdtamyycarqlyqgymdtfdswgqgtlvtvs
sastkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtktytcnvdhkpsntkvdkr

Timeline for d3nach1:

• d3nach1 is new in SCOPe 2.08-stable