Lineage for d3mugd_ (3mug D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742868Domain d3mugd_: 3mug D: [408505]
    Other proteins in same PDB: d3muga1, d3muga2, d3mugc1, d3mugc2, d3muge1, d3muge2, d3mugg1, d3mugg2, d3mugi1, d3mugi2, d3mugk1, d3mugk2
    automated match to d6shgh_
    complexed with nag

Details for d3mugd_

PDB Entry: 3mug (more details), 2.49 Å

PDB Description: crystal structure of human fab pg16, a broadly reactive and potent hiv-1 neutralizing antibody
PDB Compounds: (D:) Antibody PG16 Heavy Chain

SCOPe Domain Sequences for d3mugd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mugd_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeqlvesgggvvqpggslrlsclasgftfhkygmhwvrqapgkglewvalisddgmrkyh
sdsmwgrvtisrdnskntlylqfsslkvedtamffcareaggpiwhddvkyydfndgyyn
yhymdvwgkgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswns
galtsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepks

SCOPe Domain Coordinates for d3mugd_:

Click to download the PDB-style file with coordinates for d3mugd_.
(The format of our PDB-style files is described here.)

Timeline for d3mugd_:

  • d3mugd_ is new in SCOPe 2.08-stable