SCOP 1.69: Domain d1yvng_: 1yvn G:

Lineage for d1yvng_ (1yvn G:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.109: Gelsolin-like [55752] (2 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families)

5. Family d.109.1.1: Gelsolin-like [55754] (4 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (18 PDB entries)

8. Domain d1yvng_: 1yvn G: [40849]
   Other proteins in same PDB: d1yvna1, d1yvna2

Details for d1yvng_

PDB Entry: 1yvn, 2.1 Å

PDB Description: the yeast actin val 159 asn mutant complex with human gelsolin segment 1.

SCOP Domain Sequences for d1yvng_:

Sequence; same for both SEQRES and ATOM records:

>d1yvng_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens)}
mvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd
lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
vasgf

Timeline for d1yvng_:

• d1yvng_ first appeared (with stable ids) in SCOP 1.55
  
• d1yvng_ appears in SCOP 1.67
  
• d1yvng_ appears in SCOP 1.71
  
• d1yvng_ appears in the current release, SCOPe 2.08