Lineage for d1dgag_ (1dga G:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261128Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 261129Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 261130Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 261131Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 261145Species Human (Homo sapiens) [TaxId:9606] [55761] (15 PDB entries)
  8. 261150Domain d1dgag_: 1dga G: [40847]
    Other proteins in same PDB: d1dgaa1, d1dgaa2
    domain 1

Details for d1dgag_

PDB Entry: 1dga (more details), 1.93 Å

PDB Description: structure of dictyostelium discoideum actin complexed with mg atp and human gelsolin segment 1.

SCOP Domain Sequences for d1dgag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgag_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens)}
vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
sgf

SCOP Domain Coordinates for d1dgag_:

Click to download the PDB-style file with coordinates for d1dgag_.
(The format of our PDB-style files is described here.)

Timeline for d1dgag_: