Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.109: Gelsolin-like [55752] (2 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) |
Family d.109.1.1: Gelsolin-like [55754] (4 proteins) |
Protein Gelsolin [55759] (2 species) consists of six similar domains |
Species Human (Homo sapiens) [TaxId:9606] [55761] (18 PDB entries) |
Domain d1yagg_: 1yag G: [40846] Other proteins in same PDB: d1yaga1, d1yaga2 domain 1 domain 1 |
PDB Entry: 1yag (more details), 1.9 Å
SCOP Domain Sequences for d1yagg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yagg_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens)} mvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg vasgf
Timeline for d1yagg_: