Lineage for d1yagg_ (1yag G:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35145Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 35146Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 35147Family d.109.1.1: Gelsolin-like [55754] (3 proteins)
  6. 35148Protein Gelsolin [55759] (2 species)
  7. 35162Species Human (Homo sapiens) [TaxId:9606] [55761] (9 PDB entries)
  8. 35163Domain d1yagg_: 1yag G: [40846]
    Other proteins in same PDB: d1yaga1, d1yaga2

Details for d1yagg_

PDB Entry: 1yag (more details), 1.9 Å

PDB Description: structure of the yeast actin-human gelsolin segment 1 complex

SCOP Domain Sequences for d1yagg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yagg_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens)}
mvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd
lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
vasgf

SCOP Domain Coordinates for d1yagg_:

Click to download the PDB-style file with coordinates for d1yagg_.
(The format of our PDB-style files is described here.)

Timeline for d1yagg_: