Lineage for d3ldbc_ (3ldb C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754215Species Cricetulus migratorius [TaxId:10032] [225940] (6 PDB entries)
  8. 2754229Domain d3ldbc_: 3ldb C: [408455]
    automated match to d6shgh_
    complexed with akg, fe, gol, hg, so4

Details for d3ldbc_

PDB Entry: 3ldb (more details), 2.7 Å

PDB Description: structure of jmjd6 complexd with alpha-ketoglutarate and fab fragment.
PDB Compounds: (C:) antibody fab fragment heavy chain

SCOPe Domain Sequences for d3ldbc_:

Sequence, based on SEQRES records: (download)

>d3ldbc_ b.1.1.0 (C:) automated matches {Cricetulus migratorius [TaxId: 10032]}
qiqlqesgpglvtpsqsltltcsvtgdsitsyhwswirqfpgkklewmgyiynsggtdyn
pslksrvsitreisrnqlflqlnsvttedtatyycarrdygtyyfdywgqgtmvtvssat
ttapsvyplapacdsttsttntvtlgclvkgyfpepvtvswnsgaltsgvhtfpsvlhsg
lyslsssvtvpsstwpsqtvtcnvahpasstkvdkkivp

Sequence, based on observed residues (ATOM records): (download)

>d3ldbc_ b.1.1.0 (C:) automated matches {Cricetulus migratorius [TaxId: 10032]}
qiqlqesgpglvtpsqsltltcsvtgdsitsyhwswirqfpgkklewmgyiynsggtdyn
pslksrvsitreisrnqlflqlnsvttedtatyycarrdygtyyfdywgqgtmvtvssat
ttapsvyplapntvtlgclvkgyfpepvtvswnsgaltsgvhtfpsvlhsglyslsssvt
vpsstwpsqtvtcnvahpasstkvdkkivp

SCOPe Domain Coordinates for d3ldbc_:

Click to download the PDB-style file with coordinates for d3ldbc_.
(The format of our PDB-style files is described here.)

Timeline for d3ldbc_:

  • d3ldbc_ is new in SCOPe 2.08-stable