Lineage for d3kymj_ (3kym J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743377Domain d3kymj_: 3kym J: [408440]
    Other proteins in same PDB: d3kyma1, d3kyma2, d3kymc1, d3kymc2, d3kyme1, d3kyme2, d3kymg1, d3kymg2, d3kymi1, d3kymi2, d3kymk1, d3kymk2, d3kymm1, d3kymm2, d3kymo1, d3kymo2
    automated match to d6shgh_

Details for d3kymj_

PDB Entry: 3kym (more details), 2.62 Å

PDB Description: Crystal structure of Li33 IgG2 di-Fab
PDB Compounds: (J:) Heavy Chain Li33 IgG2

SCOPe Domain Sequences for d3kymj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kymj_ b.1.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfsiypmfwvrqapgkglewvswigpsggitky
adsvkgrftisrdnskntlylqmnslraedtatyycareghndwyfdlwgrgtlvtvssa
stkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssnfgtqtytcnvdhkpsntkvdktver

SCOPe Domain Coordinates for d3kymj_:

Click to download the PDB-style file with coordinates for d3kymj_.
(The format of our PDB-style files is described here.)

Timeline for d3kymj_:

  • d3kymj_ is new in SCOPe 2.08-stable