SCOP 1.55: Domain d1svr__: 1svr -

Lineage for d1svr__ (1svr -)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families)

5. Family d.109.1.1: Gelsolin-like [55754] (3 proteins)

6. Protein Severin, domain 2 [55757] (1 species)

7. Species Dictyostelium discoideum [TaxId:44689] [55758] (3 PDB entries)

8. Domain d1svr__: 1svr - [40833]

Details for d1svr__

PDB Entry: 1svr

PDB Description: structure of severin domain 2 in solution

SCOP Domain Sequences for d1svr__:

Sequence; same for both SEQRES and ATOM records:

>d1svr__ d.109.1.1 (-) Severin, domain 2 {Dictyostelium discoideum}
eykprllhisgdknakvaevplatsslnsgdcflldagltiyqfngsksspqeknkaaev
araidaerkglpkvevfcetdsdipaefwkllgg

Timeline for d1svr__:

• d1svr__ appears in SCOP 1.57
  
• d1svr__ appears in the current release, SCOPe 2.08, called d1svra_