Lineage for d1svq__ (1svq -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35145Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 35146Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 35147Family d.109.1.1: Gelsolin-like [55754] (3 proteins)
  6. 35174Protein Severin, domain 2 [55757] (1 species)
  7. 35175Species Dictyostelium discoideum [TaxId:44689] [55758] (3 PDB entries)
  8. 35177Domain d1svq__: 1svq - [40832]

Details for d1svq__

PDB Entry: 1svq (more details)

PDB Description: structure of severin domain 2 in solution

SCOP Domain Sequences for d1svq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svq__ d.109.1.1 (-) Severin, domain 2 {Dictyostelium discoideum}
eykprllhisgdknakvaevplatsslnsgdcflldagltiyqfngsksspqeknkaaev
araidaerkglpkvevfcetdsdipaefwkllgg

SCOP Domain Coordinates for d1svq__:

Click to download the PDB-style file with coordinates for d1svq__.
(The format of our PDB-style files is described here.)

Timeline for d1svq__: