Lineage for d3cfeb_ (3cfe B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744845Domain d3cfeb_: 3cfe B: [408310]
    Other proteins in same PDB: d3cfea1, d3cfea2, d3cfel1, d3cfel2
    automated match to d6shgh_
    complexed with gol, so4

Details for d3cfeb_

PDB Entry: 3cfe (more details), 2.99 Å

PDB Description: Crystal structure of purple-fluorescent antibody EP2-25C10
PDB Compounds: (B:) purple-fluorescent antibody ep2-25c10-igg2b heavy chain

SCOPe Domain Sequences for d3cfeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfeb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqesgpglvkpsqslsltctvtgysitsdyawnwlrqlpgnklewmgyisysgriry
npslkrrisitrdtsknqfflqlnsvttedtatyycarsdygnygrgdywgqgtsvtvss
akttppsvyplapgcgdttgssvtsgclvkgyfpesvtvtwnsgslsssvhtfpallqsg
lytmsssvtvpsstwpsetvtcsvahpassttvdkklep

SCOPe Domain Coordinates for d3cfeb_:

Click to download the PDB-style file with coordinates for d3cfeb_.
(The format of our PDB-style files is described here.)

Timeline for d3cfeb_:

  • d3cfeb_ is new in SCOPe 2.08-stable