Lineage for d1svy__ (1svy -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily) Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) 
Family d.109.1.1: Gelsolin-like [55754] (3 proteins) Protein Severin, domain 2 [55757] (1 species) Species Dictyostelium discoideum [TaxId:44689] [55758] (3 PDB entries) 
Domain d1svy__: 1svy - [40831]
Details for d1svy__
PDB Entry: 1svy (more details), 1.75 Å
PDB Description: severin domain 2, 1.75 angstrom crystal structure
SCOP Domain Sequences for d1svy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svy__ d.109.1.1 (-) Severin, domain 2 {Dictyostelium discoideum}
eykprllhisgdknakvaevplatsslnsgdcflldagltiyqfngsksspqeknkaaev
araidaerkglpkvevfcetdsdipaefwkllggkgaiaakh
SCOP Domain Coordinates for d1svy__:
Click to download the PDB-style file with coordinates for d1svy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1svy__:
- d1svy__ appears in SCOP 1.57
- d1svy__ appears in the current release, SCOPe 2.08, called d1svya_
View in 3D