Lineage for d3cfbh_ (3cfb H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744191Domain d3cfbh_: 3cfb H: [408307]
    Other proteins in same PDB: d3cfba1, d3cfba2, d3cfbl1, d3cfbl2
    automated match to d6shgh_
    complexed with gol, spb

Details for d3cfbh_

PDB Entry: 3cfb (more details), 1.6 Å

PDB Description: High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene hapten at 100K
PDB Compounds: (H:) blue fluorescent antibody ep2-19g2-igg2b heavy chain

SCOPe Domain Sequences for d3cfbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfbh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklvesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityyp
dsvkgrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtlvtvssakttpp
svyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmss
svtvpsstwpsetvtcsvahpassttvdkklep

SCOPe Domain Coordinates for d3cfbh_:

Click to download the PDB-style file with coordinates for d3cfbh_.
(The format of our PDB-style files is described here.)

Timeline for d3cfbh_:

  • d3cfbh_ is new in SCOPe 2.08-stable