Lineage for d2ipth_ (2ipt H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744278Domain d2ipth_: 2ipt H: [408115]
    Other proteins in same PDB: d2iptl2
    automated match to d6shgh_
    complexed with acm

Details for d2ipth_

PDB Entry: 2ipt (more details), 2 Å

PDB Description: PFA1 Fab Fragment
PDB Compounds: (H:) IgG2a Fab fragment Light Chain Kappa

SCOPe Domain Sequences for d2ipth_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ipth_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvtlkesgpgilkpsqtlsltcsfsgfslstsgmgvgwirqpsgkglewlahiwwdddks
ynpslksqltiskdaarnqvflritsvdtadtatyycvrrahttvlgdwfaywgqgtlvt
vsaakttapsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
qsglytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d2ipth_:

Click to download the PDB-style file with coordinates for d2ipth_.
(The format of our PDB-style files is described here.)

Timeline for d2ipth_:

  • d2ipth_ is new in SCOPe 2.08-stable