Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
Domain d2ipth_: 2ipt H: [408115] Other proteins in same PDB: d2iptl2 automated match to d6shgh_ complexed with acm |
PDB Entry: 2ipt (more details), 2 Å
SCOPe Domain Sequences for d2ipth_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ipth_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qvtlkesgpgilkpsqtlsltcsfsgfslstsgmgvgwirqpsgkglewlahiwwdddks ynpslksqltiskdaarnqvflritsvdtadtatyycvrrahttvlgdwfaywgqgtlvt vsaakttapsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl qsglytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d2ipth_: