Lineage for d2gjzb_ (2gjz B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744676Domain d2gjzb_: 2gjz B: [408085]
    Other proteins in same PDB: d2gjza2, d2gjzl2
    automated match to d6shgh_
    complexed with zn

Details for d2gjzb_

PDB Entry: 2gjz (more details), 2.65 Å

PDB Description: Structure of Catalytic Elimination Antibody 13G5 from a crystal in space group P2(1)
PDB Compounds: (B:) Catalytic elimination antibody 13G5 heavy chain

SCOPe Domain Sequences for d2gjzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjzb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlkesgpglvapsqslsitctvsgfsltnygvdwvrqppgkglewvgviwsggstnyn
salmsrlsiskdnsksqvflkmnslqtddtavyycakhwggyyipygmdhwgqgttvtvs
sakttppsvyplapgcgdttgssvtlgclvkgyfpepvtvtwnsgslsssvhtfpallqs
glytmsssvtvpsstwpsqtvtcsvahpassttvdkklepr

SCOPe Domain Coordinates for d2gjzb_:

Click to download the PDB-style file with coordinates for d2gjzb_.
(The format of our PDB-style files is described here.)

Timeline for d2gjzb_:

  • d2gjzb_ is new in SCOPe 2.08-stable