Lineage for d2fl5f_ (2fl5 F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743605Domain d2fl5f_: 2fl5 F: [408070]
    Other proteins in same PDB: d2fl5a1, d2fl5a2, d2fl5c1, d2fl5c2, d2fl5e1, d2fl5e2, d2fl5l1, d2fl5l2
    automated match to d6shgh_
    complexed with rbf

Details for d2fl5f_

PDB Entry: 2fl5 (more details), 3 Å

PDB Description: cofactor-containing antibodies: crystal structure of the original yellow antibody
PDB Compounds: (F:) Immunoglobulin Igg1 Heavy chain

SCOPe Domain Sequences for d2fl5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fl5f_ b.1.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpgeslklsctasgfslsnyymtwvrqapgkglewvtnirpdetekfy
sdsvkgrftvsrdnarnslfnsmslqrvedtatyycarvsdfgdygpdfwgqgtlvsvts
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtktytcnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d2fl5f_:

Click to download the PDB-style file with coordinates for d2fl5f_.
(The format of our PDB-style files is described here.)

Timeline for d2fl5f_:

  • d2fl5f_ is new in SCOPe 2.08-stable