Lineage for d1zanh_ (1zan H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761339Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)
  8. 2761340Domain d1zanh_: 1zan H: [407996]
    automated match to d6shgh_
    complexed with cl

Details for d1zanh_

PDB Entry: 1zan (more details), 1.7 Å

PDB Description: Crystal structure of anti-NGF AD11 Fab
PDB Compounds: (H:) Fab AD11 Heavy Chain

SCOPe Domain Sequences for d1zanh_:

Sequence, based on SEQRES records: (download)

>d1zanh_ b.1.1.0 (H:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qvqlkesgpglvqpsqtlsltctvsgfsltnnnvnwvrqatgrglewmggvwaggatdyn
salksrltitrdtsksqvflkmhslqsedtatyycardggyssstlyamdawgqgttvtv
ssasttapsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslasgvhtfpavlq
sglytlsssvtvpaspwaseavtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1zanh_ b.1.1.0 (H:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qvqlkesgpglvqpsqtlsltctvsgfsltnnnvnwvrqatgrglewmggvwaggatdyn
salksrltitrdtsksqvflkmhslqsedtatyycardggyssstlyamdawgqgttvtv
ssasttapsvyplapgsmvtlgclvkgyfpepvtvtwnsgslasgvhtfpavlqsglytl
sssvtvpaspwaseavtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d1zanh_:

Click to download the PDB-style file with coordinates for d1zanh_.
(The format of our PDB-style files is described here.)

Timeline for d1zanh_:

  • d1zanh_ is new in SCOPe 2.08-stable