Lineage for d1ty7h_ (1ty7 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745032Domain d1ty7h_: 1ty7 H: [407938]
    Other proteins in same PDB: d1ty7a_, d1ty7l3, d1ty7l4
    automated match to d6shgh_
    complexed with 180, ca, gol, mg, nag, ndg

Details for d1ty7h_

PDB Entry: 1ty7 (more details), 3.1 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (H:) monoclonal antibody 10e5 heavy chain

SCOPe Domain Sequences for d1ty7h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty7h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtyvhwvkqrpeqglewigridpangytky
dpkfqgkatitadtssntaylqlssltsedtavyycvrplydyyamdywgqgtsvtvssa
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d1ty7h_:

Click to download the PDB-style file with coordinates for d1ty7h_.
(The format of our PDB-style files is described here.)

Timeline for d1ty7h_:

  • d1ty7h_ is new in SCOPe 2.08-stable