Lineage for d1e42b2 (1e42 B:825-937)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209048Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
    beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet
  4. 2209049Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) (S)
  5. 2209050Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)
  6. 2209063Protein Beta2-adaptin AP2, C-terminal subdomain [55715] (1 species)
  7. 2209064Species Human (Homo sapiens) [TaxId:9606] [55716] (4 PDB entries)
  8. 2209067Domain d1e42b2: 1e42 B:825-937 [40793]
    Other proteins in same PDB: d1e42a1, d1e42b1
    complexed with cl, dtd, gol, mg, ni

Details for d1e42b2

PDB Entry: 1e42 (more details), 1.7 Å

PDB Description: beta2-adaptin appendage domain, from clathrin adaptor ap2
PDB Compounds: (B:) ap-2 complex subunit beta

SCOPe Domain Sequences for d1e42b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e42b2 d.105.1.1 (B:825-937) Beta2-adaptin AP2, C-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn

SCOPe Domain Coordinates for d1e42b2:

Click to download the PDB-style file with coordinates for d1e42b2.
(The format of our PDB-style files is described here.)

Timeline for d1e42b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e42b1