SCOP 1.61: Domain d1pysb5: 1pys B:475-681

Lineage for d1pysb5 (1pys B:475-681)

Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)
Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
Species Thermus thermophilus (Thermus aquaticus) [55704] (5 PDB entries)
Domain d1pysb5: 1pys B:475-681 [40779]
Other proteins in same PDB: d1pysa_, d1pysb1, d1pysb2, d1pysb3, d1pysb4, d1pysb6

Details for d1pysb5

PDB Entry: 1pys (more details), 2.9 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1pysb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pysb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus (Thermus aquaticus)}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

SCOP Domain Coordinates for d1pysb5:

Click to download the PDB-style file with coordinates for d1pysb5.
(The format of our PDB-style files is described here.)

Timeline for d1pysb5: