SCOPe 2.08: Domain d1iisc4: 1iis C:87-171

Lineage for d1iisc4 (1iis C:87-171)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)

8. Domain d1iisc4: 1iis C:87-171 [407772]
   Other proteins in same PDB: d1iisb3, d1iisb4
   automated match to d1fnla2
   complexed with man

Details for d1iisc4

PDB Entry: 1iis, 3 Å

PDB Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (orthorhombic)

PDB Compounds: (C:) low affinity immunoglobulin gamma fc region receptor III-b

SCOPe Domain Sequences for d1iisc4:

Sequence; same for both SEQRES and ATOM records:

>d1iisc4 b.1.1.4 (C:87-171) automated matches {Human (Homo sapiens) [TaxId: 9606]}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatl
kdsgsyfcrglvgsknvssetvnit

Timeline for d1iisc4:

• d1iisc4 is new in SCOPe 2.08-stable