Lineage for d1b70a_ (1b70 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260809Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 260810Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 260811Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)
  6. 260893Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 260894Species Thermus thermophilus and (Thermus aquaticus) [55702] (5 PDB entries)
  8. 260898Domain d1b70a_: 1b70 A: [40777]
    Other proteins in same PDB: d1b70b1, d1b70b2, d1b70b3, d1b70b4, d1b70b5, d1b70b6

Details for d1b70a_

PDB Entry: 1b70 (more details), 2.7 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalanine

SCOP Domain Sequences for d1b70a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b70a_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus and (Thermus aquaticus)}
vdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhpa
rdmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfrf
eqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepga
qfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlaml
rygipdiryffggrlkfleqfkgvl

SCOP Domain Coordinates for d1b70a_:

Click to download the PDB-style file with coordinates for d1b70a_.
(The format of our PDB-style files is described here.)

Timeline for d1b70a_: