Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins) |
Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species) |
Species Thermus thermophilus and (Thermus aquaticus) [55702] (5 PDB entries) |
Domain d1b70a_: 1b70 A: [40777] Other proteins in same PDB: d1b70b1, d1b70b2, d1b70b3, d1b70b4, d1b70b5, d1b70b6 |
PDB Entry: 1b70 (more details), 2.7 Å
SCOP Domain Sequences for d1b70a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b70a_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus and (Thermus aquaticus)} vdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhpa rdmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfrf eqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepga qfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlaml rygipdiryffggrlkfleqfkgvl
Timeline for d1b70a_: