SCOP 1.65: Domain d1pysa_: 1pys A:

Lineage for d1pysa_ (1pys A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)

6. Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)

7. Species Thermus thermophilus and (Thermus aquaticus) [55702] (5 PDB entries)

8. Domain d1pysa_: 1pys A: [40775]
   Other proteins in same PDB: d1pysb1, d1pysb2, d1pysb3, d1pysb4, d1pysb5, d1pysb6
   complexed with mg

Details for d1pysa_

PDB Entry: 1pys, 2.9 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1pysa_:

Sequence; same for both SEQRES and ATOM records:

>d1pysa_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus and (Thermus aquaticus)}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

Timeline for d1pysa_:

• d1pysa_ first appeared (with stable ids) in SCOP 1.55
  
• d1pysa_ appears in SCOP 1.63
  
• d1pysa_ appears in SCOP 1.67
  
• d1pysa_ appears in the current release, SCOPe 2.08