SCOPe 2.08: Domain d6zhla2: 6zhl A:64-288

Lineage for d6zhla2 (6zhl A:64-288)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:367830] [359829] (6 PDB entries)

8. Domain d6zhla2: 6zhl A:64-288 [407685]
   Other proteins in same PDB: d6zhla1, d6zhla3
   automated match to d1t9ha2
   complexed with edo, g4p, pge, zn

Details for d6zhla2

PDB Entry: 6zhl, 1.94 Å

PDB Description: crystal structure of staphylococcus aureus rsga bound to ppgpp.

PDB Compounds: (A:) Small ribosomal subunit biogenesis GTPase RsgA

SCOPe Domain Sequences for d6zhla2:

Sequence, based on SEQRES records:

>d6zhla2 c.37.1.0 (A:64-288) automated matches {Staphylococcus aureus [TaxId: 367830]}
nelkrppvsnidtlvivmsavepnfstqlldrflviahsyqlnarilvtkkdktpiekqf
einellkiyenigyetefigndddrkkiveawpaglivlsgqsgvgkstflnhyrpelnl
etndiskslnrgkhttrhvelferqngyiadtpgfsaldfdhidkdeikdyflelnryge
tckfrncnhikepncnvkhqleigniaqfrydhylqlfneisnrk

Sequence, based on observed residues (ATOM records):

>d6zhla2 c.37.1.0 (A:64-288) automated matches {Staphylococcus aureus [TaxId: 367830]}
nelkrppvsnidtlvivmsavepnfstqlldrflviahsyqlnarilvtkkdktpiekqf
einellkiyenigyetefigndddrkkiveawpaglivlsgqsgvgkstflnhyrpehve
lferqngyiadtpgfsaldfdhidkdeikdyflelnrygetckfrncnhikepncnvkhq
leigniaqfrydhylqlfneisnrk

Timeline for d6zhla2:

• d6zhla2 first appeared in SCOPe 2.07