Lineage for d6ztka_ (6ztk A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2542784Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2542960Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2542961Protein automated matches [190558] (13 species)
    not a true protein
  7. 2542998Species Ixodes ricinus [TaxId:34613] [353509] (2 PDB entries)
  8. 2542999Domain d6ztka_: 6ztk A: [407679]
    automated match to d3lh4a_
    complexed with so4, trt

Details for d6ztka_

PDB Entry: 6ztk (more details), 1.55 Å

PDB Description: crystal structure of mialostatin, a gut cystatin from the hard tick ixodes ricinus
PDB Compounds: (A:) Mialostatin

SCOPe Domain Sequences for d6ztka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ztka_ d.17.1.0 (A:) automated matches {Ixodes ricinus [TaxId: 34613]}
gwktqdptnpkfenlahyavstqvegreyydtvlellevqtqivagvnyklkftttqstc
kiesgveyskelcqpktnkveavctsiiytvpwqnikrvlsyhcdapn

SCOPe Domain Coordinates for d6ztka_:

Click to download the PDB-style file with coordinates for d6ztka_.
(The format of our PDB-style files is described here.)

Timeline for d6ztka_: