Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (19 species) includes rudiment esterase domain |
Species Influenza a virus (strain a/bangkok/1/1979 h3n2) [TaxId:385630] [407368] (1 PDB entry) |
Domain d6xpob1: 6xpo B:7-326 [407665] Other proteins in same PDB: d6xpoa2, d6xpob2, d6xpoc2 automated match to d5k9kf1 complexed with nag |
PDB Entry: 6xpo (more details), 3 Å
SCOPe Domain Sequences for d6xpob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xpob1 b.19.1.2 (B:7-326) Hemagglutinin {Influenza a virus (strain a/bangkok/1/1979 h3n2) [TaxId: 385630]} dnstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctl idallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfn wtgvtqsggsyackrgsdnsffsrlnwlyeseskypvlnvtmpnngnfdklyiwgvhhps tdkeqtklyvrasgrvtvstkrsqqtiipnigsrpwvrglssgisiywtivkpgdillin sngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacp kyvkqntlklatgmrnvpek
Timeline for d6xpob1:
View in 3D Domains from other chains: (mouse over for more information) d6xpoa1, d6xpoa2, d6xpoc1, d6xpoc2 |