SCOPe 2.07: Domain d6xpob1: 6xpo B:7-326

Lineage for d6xpob1 (6xpo B:7-326)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (19 species)
   includes rudiment esterase domain

7. Species Influenza a virus (strain a/bangkok/1/1979 h3n2) [TaxId:385630] [407368] (1 PDB entry)

8. Domain d6xpob1: 6xpo B:7-326 [407665]
   Other proteins in same PDB: d6xpoa2, d6xpob2, d6xpoc2
   automated match to d5k9kf1
   complexed with nag

Details for d6xpob1

PDB Entry: 6xpo, 3 Å

PDB Description: influenza hemagglutinin a/bangkok/01/1979(h3n2)

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6xpob1:

Sequence; same for both SEQRES and ATOM records:

>d6xpob1 b.19.1.2 (B:7-326) Hemagglutinin {Influenza a virus (strain a/bangkok/1/1979 h3n2) [TaxId: 385630]}
dnstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctl
idallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfn
wtgvtqsggsyackrgsdnsffsrlnwlyeseskypvlnvtmpnngnfdklyiwgvhhps
tdkeqtklyvrasgrvtvstkrsqqtiipnigsrpwvrglssgisiywtivkpgdillin
sngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacp
kyvkqntlklatgmrnvpek

Timeline for d6xpob1:

• d6xpob1 is new in SCOPe 2.07-stable
  
• d6xpob1 appears in the current release, SCOPe 2.08