SCOPe 2.07: Domain d6zoux_: 6zou X:

Lineage for d6zoux_ (6zou X:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d6zoux_: 6zou X: [407653]
   Other proteins in same PDB: d6zoua_, d6zouc1, d6zouc2, d6zoud_, d6zoue_, d6zouf_, d6zoug_, d6zouh_, d6zoum_, d6zouo_, d6zoup_, d6zouq1, d6zouq2, d6zour_, d6zous_, d6zout_, d6zouu_, d6zouv_
   automated match to d1rypk_
   complexed with cl, mg, qoh

Details for d6zoux_

PDB Entry: 6zou, 2.9 Å

PDB Description: yeast 20s proteasome in complex with glidobactin-like natural product hb333

PDB Compounds: (X:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d6zoux_:

Sequence; same for both SEQRES and ATOM records:

>d6zoux_ d.153.1.4 (X:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddf

Timeline for d6zoux_:

• d6zoux_ is new in SCOPe 2.07-stable
  
• d6zoux_ appears in the current release, SCOPe 2.08