Lineage for d6zxob_ (6zxo B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2579104Protein automated matches [190469] (17 species)
    not a true protein
  7. 2579169Species Human (Homo sapiens) [TaxId:9606] [189245] (15 PDB entries)
  8. 2579192Domain d6zxob_: 6zxo B: [407649]
    automated match to d4eb4a_
    complexed with d16, edo, ufp

Details for d6zxob_

PDB Entry: 6zxo (more details), 2.6 Å

PDB Description: crystal structure of his-tagged human thymidylate synthase (ht-hts) in complex with fdump and raltitrexed (tomudex)
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d6zxob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zxob_ d.117.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptikmemav

SCOPe Domain Coordinates for d6zxob_:

Click to download the PDB-style file with coordinates for d6zxob_.
(The format of our PDB-style files is described here.)

Timeline for d6zxob_: