Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein automated matches [190469] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189245] (15 PDB entries) |
Domain d6zxob_: 6zxo B: [407649] automated match to d4eb4a_ complexed with d16, edo, ufp |
PDB Entry: 6zxo (more details), 2.6 Å
SCOPe Domain Sequences for d6zxob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zxob_ d.117.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptikmemav
Timeline for d6zxob_: