SCOPe 2.07: Domain d6zp8c1: 6zp8 C:1-234

Lineage for d6zp8c1 (6zp8 C:1-234)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d6zp8c1: 6zp8 C:1-234 [407588]
   Other proteins in same PDB: d6zp8c2, d6zp8e_, d6zp8g_, d6zp8i_, d6zp8j_, d6zp8k_, d6zp8l_, d6zp8n_, d6zp8o_, d6zp8q2, d6zp8s_, d6zp8u_, d6zp8w_, d6zp8x_, d6zp8y_, d6zp8z_
   automated match to d1rypd_
   complexed with cl, mg, qoe

Details for d6zp8c1

PDB Entry: 6zp8, 3 Å

PDB Description: yeast 20s proteasome in complex with glidobactin-like natural product hb335

PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d6zp8c1:

Sequence; same for both SEQRES and ATOM records:

>d6zp8c1 d.153.1.4 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d6zp8c1:

• d6zp8c1 is new in SCOPe 2.07-stable
  
• d6zp8c1 appears in the current release, SCOPe 2.08