SCOPe 2.07: Domain d6z7ia_: 6z7i A:

Lineage for d6z7ia_ (6z7i A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (30 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [188184] (9 PDB entries)

8. Domain d6z7ia_: 6z7i A: [407582]
   automated match to d1ylpa_
   complexed with gol, so4; mutant

Details for d6z7ia_

PDB Entry: 6z7i, 0.98 Å

PDB Description: crystal structure of ctx-m-15 e166q mutant apoenzyme

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6z7ia_:

Sequence; same for both SEQRES and ATOM records:

>d6z7ia_ e.3.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
advqqklaelerqsggrlgvalintadnsqilyraderfamcstskvmaaaavlkksese
pnllnqrveikksdlvnynpiaekhvngtmslaelsaaalqysdnvamnkliahvggpas
vtafarqlgdetfrldrtqptlntaipgdprdttspramaqtlrnltlgkalgdsqraql
vtwmkgnttgaasiqaglpaswvvgdktgsggygttndiaviwpkdraplilvtyftqpq
pkaesrrdvlasaakivtdg

Timeline for d6z7ia_:

• d6z7ia_ is new in SCOPe 2.07-stable
  
• d6z7ia_ appears in the current release, SCOPe 2.08