Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
Protein automated matches [236563] (10 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276244] (9 PDB entries) |
Domain d6zooc_: 6zoo C: [407561] Other proteins in same PDB: d6zoo1_, d6zoo2_, d6zoo3_, d6zoo4_, d6zooa_, d6zoob_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zooj_, d6zool_, d6zoop_ automated match to d5l8rc_ complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6zoo (more details), 2.74 Å
SCOPe Domain Sequences for d6zooc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zooc_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd flsvrvylwhettrsmglay
Timeline for d6zooc_: