Lineage for d6xq2d_ (6xq2 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776074Species Influenza a virus (a/texas/50/2012(h3n2)) [TaxId:1321009] [347902] (3 PDB entries)
  8. 2776083Domain d6xq2d_: 6xq2 D: [407513]
    Other proteins in same PDB: d6xq2b1, d6xq2b2, d6xq2c_, d6xq2e1, d6xq2e2, d6xq2f_
    automated match to d5umna_
    complexed with nag

Details for d6xq2d_

PDB Entry: 6xq2 (more details), 3 Å

PDB Description: human antibody s8v2-37 in complex with the influenza hemagglutinin head domain of a/texas/50/2012(h3n2)
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d6xq2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xq2d_ b.19.1.2 (D:) automated matches {Influenza a virus (a/texas/50/2012(h3n2)) [TaxId: 1321009]}
qnssigeicdsphqildgenctlidallgdpqcdgfqnkkwdlfverskaysncypydvp
dyaslrslvassgtlefnnesfnwngvtqngtssacirrsnnsffsrlnwlthlnfkypa
lnvtmpnneqfdklyiwgvhhpvtdkdqiflyaqpsgritvstkrsqqavipnigfrpri
rnipsrisiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkcksecit
pngsipndkpfqnvnritygacpry

SCOPe Domain Coordinates for d6xq2d_:

Click to download the PDB-style file with coordinates for d6xq2d_.
(The format of our PDB-style files is described here.)

Timeline for d6xq2d_: