Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (19 species) not a true protein |
Species Influenza a virus (a/texas/50/2012(h3n2)) [TaxId:1321009] [347902] (3 PDB entries) |
Domain d6xq2d_: 6xq2 D: [407513] Other proteins in same PDB: d6xq2b1, d6xq2b2, d6xq2c_, d6xq2e1, d6xq2e2, d6xq2f_ automated match to d5umna_ complexed with nag |
PDB Entry: 6xq2 (more details), 3 Å
SCOPe Domain Sequences for d6xq2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xq2d_ b.19.1.2 (D:) automated matches {Influenza a virus (a/texas/50/2012(h3n2)) [TaxId: 1321009]} qnssigeicdsphqildgenctlidallgdpqcdgfqnkkwdlfverskaysncypydvp dyaslrslvassgtlefnnesfnwngvtqngtssacirrsnnsffsrlnwlthlnfkypa lnvtmpnneqfdklyiwgvhhpvtdkdqiflyaqpsgritvstkrsqqavipnigfrpri rnipsrisiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkcksecit pngsipndkpfqnvnritygacpry
Timeline for d6xq2d_: