Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) automatically mapped to Pfam PF01701 |
Family f.23.18.0: automated matches [276196] (1 protein) not a true family |
Protein automated matches [276198] (5 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276201] (9 PDB entries) |
Domain d6zooj_: 6zoo J: [407512] Other proteins in same PDB: d6zoo1_, d6zoo2_, d6zoo3_, d6zoo4_, d6zooa_, d6zoob_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zool_, d6zoop_ automated match to d5l8rj_ complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6zoo (more details), 2.74 Å
SCOPe Domain Sequences for d6zooj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zooj_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} mrdlktylsvapvastlwfaalagllieinrffpdaltfpff
Timeline for d6zooj_: