SCOPe 2.08: Domain d6zoo1_: 6zoo 1:

Lineage for d6zoo1_ (6zoo 1:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
   membrane all-alpha fold; three transmembrane helices

4. Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families)
   duplication: contains two structural repeats

5. Family f.43.1.0: automated matches [276197] (1 protein)
   not a true family

6. Protein automated matches [276200] (4 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries)

8. Domain d6zoo1_: 6zoo 1: [407503]
   Other proteins in same PDB: d6zooa_, d6zoob_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zooj_, d6zool_, d6zoop_
   automated match to d5l8r1_
   complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6zoo1_

PDB Entry: 6zoo, 2.74 Å

PDB Description: photosystem i reduced plastocyanin complex

PDB Compounds: (1:) Chlorophyll a-b binding protein 6, chloroplastic

SCOPe Domain Sequences for d6zoo1_:

Sequence; same for both SEQRES and ATOM records:

>d6zoo1_ f.43.1.0 (1:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
dwmpgqprpsyldgsapgdfgfdplrlgevpenlerfkeselihcrwamlavpgilvpea
lglgnwvkaqewaalpggqatylgnpvpwgtlptilvieflsiafvehqrsmekdpekkk
ypggafdplgyskdpkkfheykikevkngrlallafvgicvqqsaypgtgplenlathla
dpwhntignvlip

Timeline for d6zoo1_:

• d6zoo1_ first appeared in SCOPe 2.07