Lineage for d6zflv_ (6zfl V:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638318Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 2638330Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 2638333Species Human (Homo sapiens) [TaxId:9606] [57506] (22 PDB entries)
    Uniprot P15692 40-133
  8. 2638334Domain d6zflv_: 6zfl V: [407485]
    automated match to d1vppv_
    complexed with mpd, po4

Details for d6zflv_

PDB Entry: 6zfl (more details), 1.6 Å

PDB Description: high resolution structure of vegf-a 12:107 crystallized in tetragonal form
PDB Compounds: (V:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d6zflv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zflv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
mevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt
eesnitmqimrikphqgqhigemsflqhnkcecrpk

SCOPe Domain Coordinates for d6zflv_:

Click to download the PDB-style file with coordinates for d6zflv_.
(The format of our PDB-style files is described here.)

Timeline for d6zflv_: