SCOPe 2.07: Domain d6zflv_: 6zfl V:

Lineage for d6zflv_ (6zfl V:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (22 PDB entries)
   Uniprot P15692 40-133

8. Domain d6zflv_: 6zfl V: [407485]
   automated match to d1vppv_
   complexed with mpd, po4

Details for d6zflv_

PDB Entry: 6zfl, 1.6 Å

PDB Description: high resolution structure of vegf-a 12:107 crystallized in tetragonal form

PDB Compounds: (V:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d6zflv_:

Sequence; same for both SEQRES and ATOM records:

>d6zflv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
mevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt
eesnitmqimrikphqgqhigemsflqhnkcecrpk

Timeline for d6zflv_:

• d6zflv_ is new in SCOPe 2.07-stable
  
• d6zflv_ appears in the current release, SCOPe 2.08