Lineage for d6zana_ (6zan A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2424882Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2424883Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
    common fold is rather distorted
  6. 2424913Protein Isopenicillin N synthase [51199] (3 species)
  7. 2424946Species Emericella nidulans [TaxId:227321] [407419] (13 PDB entries)
  8. 2424948Domain d6zana_: 6zan A: [407483]
    automated match to d1bk0a_
    complexed with acv, fe, no, so4

Details for d6zana_

PDB Entry: 6zan (more details), 1.35 Å

PDB Description: isopenicillin n synthase in complex with fe, the oxygen surrogate no and acv.
PDB Compounds: (A:) isopenicillin n synthase

SCOPe Domain Sequences for d6zana_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zana_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans [TaxId: 227321]}
vskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhm
sitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpt
hevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlas
vvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdie
addtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepn
gksdreplsygdylqnglvslinkngqt

SCOPe Domain Coordinates for d6zana_:

Click to download the PDB-style file with coordinates for d6zana_.
(The format of our PDB-style files is described here.)

Timeline for d6zana_: