SCOPe 2.08: Domain d6xq2e1: 6xq2 E:1-106

Lineage for d6xq2e1 (6xq2 E:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6xq2e1: 6xq2 E:1-106 [407444]
   Other proteins in same PDB: d6xq2a_, d6xq2b2, d6xq2c_, d6xq2d_, d6xq2e2, d6xq2f_
   automated match to d1dn0a1
   complexed with nag

Details for d6xq2e1

PDB Entry: 6xq2, 3 Å

PDB Description: human antibody s8v2-37 in complex with the influenza hemagglutinin head domain of a/texas/50/2012(h3n2)

PDB Compounds: (E:) antibody S8V2-37 light chain

SCOPe Domain Sequences for d6xq2e1:

Sequence; same for both SEQRES and ATOM records:

>d6xq2e1 b.1.1.0 (E:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aiqltqspsslsasvgdrvtitcrtsqgistplawyqhkpgkspkllihdafslesgvps
rfsgsgsgtdfsltissvqpedfatyycqqfydypitfgqgtrlei

Timeline for d6xq2e1:

• d6xq2e1 first appeared in SCOPe 2.07