SCOPe 2.07: Domain d6y2ya1: 6y2y A:4-294

Lineage for d6y2ya1 (6y2y A:4-294)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (205 PDB entries)
   Uniprot P00431

8. Domain d6y2ya1: 6y2y A:4-294 [407366]
   Other proteins in same PDB: d6y2ya2
   automated match to d2rbtx_
   complexed with edo, hem

Details for d6y2ya1

PDB Entry: 6y2y, 1.7 Å

PDB Description: the crystal structure of engineered cytochrome c peroxidase from saccharomyces cerevisiae with trp51 to s-trp51 and trp191phe modifications

PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d6y2ya1:

Sequence; same for both SEQRES and ATOM records:

>d6y2ya1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlaxhtsgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpfgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d6y2ya1:

• d6y2ya1 is new in SCOPe 2.07-stable
  
• d6y2ya1 appears in the current release, SCOPe 2.08