Lineage for d6xpxa_ (6xpx A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386298Species Influenza a virus [TaxId:387139] [369088] (2 PDB entries)
  8. 2386301Domain d6xpxa_: 6xpx A: [407349]
    Other proteins in same PDB: d6xpxc1, d6xpxc2
    automated match to d3s13a_
    complexed with 1pe, bcn, gol, nag

Details for d6xpxa_

PDB Entry: 6xpx (more details), 2.6 Å

PDB Description: human antibody s1v2-51 in complex with the influenza hemagglutinin head domain of a/aichi/2/1968 (x-31)(h3n2)
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6xpxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xpxa_ b.19.1.0 (A:) automated matches {Influenza a virus [TaxId: 387139]}
elvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypy
dvpdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgst
ypvlnvtmpnndnfdklyiwgihhpstdqeqtslyvqasgrvtvstrrsqqtiipnigsr
pwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtcise
citpngsipndkpfqnvnkitygacpkyvkq

SCOPe Domain Coordinates for d6xpxa_:

Click to download the PDB-style file with coordinates for d6xpxa_.
(The format of our PDB-style files is described here.)

Timeline for d6xpxa_: