Lineage for d6xvud_ (6xvu D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464198Species Deinococcus radiodurans [TaxId:243230] [407321] (1 PDB entry)
  8. 2464202Domain d6xvud_: 6xvu D: [407348]
    automated match to d1jlka_
    complexed with ca

Details for d6xvud_

PDB Entry: 6xvu (more details), 2.1 Å

PDB Description: bacteriophytochrome response regulator from deinococcus radiodurans
PDB Compounds: (D:) Response regulator

SCOPe Domain Sequences for d6xvud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xvud_ c.23.1.0 (D:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
vplrlllvednaadiflmemaleyssvhtellvardglealelleqaktggpfpdlilld
lnmprvdgfellqalradphlahlpaivlttsndpsdvkrayalqansyltkpstledfl
qlierltaywfgtaaipqtyq

SCOPe Domain Coordinates for d6xvud_:

Click to download the PDB-style file with coordinates for d6xvud_.
(The format of our PDB-style files is described here.)

Timeline for d6xvud_: