Lineage for d6x21a1 (6x21 A:239-348)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2577113Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
    contains PAC motif
  6. 2577117Protein automated matches [191006] (1 species)
    not a true protein
  7. 2577118Species Human (Homo sapiens) [TaxId:9606] [188753] (22 PDB entries)
  8. 2577125Domain d6x21a1: 6x21 A:239-348 [407294]
    Other proteins in same PDB: d6x21a2, d6x21b_
    automated match to d5ufpa_
    complexed with ukj

Details for d6x21a1

PDB Entry: 6x21 (more details), 1.54 Å

PDB Description: crystal structure of pt1673 bound to hif2a-b*:arnt-b* complex
PDB Compounds: (A:) Endothelial PAS domain-containing protein 1

SCOPe Domain Sequences for d6x21a1:

Sequence, based on SEQRES records: (download)

>d6x21a1 d.110.3.7 (A:239-348) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseie

Sequence, based on observed residues (ATOM records): (download)

>d6x21a1 d.110.3.7 (A:239-348) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviypqcimcvnyvlseie

SCOPe Domain Coordinates for d6x21a1:

Click to download the PDB-style file with coordinates for d6x21a1.
(The format of our PDB-style files is described here.)

Timeline for d6x21a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6x21a2
View in 3D
Domains from other chains:
(mouse over for more information)
d6x21b_