Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins) contains PAC motif |
Protein automated matches [191006] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188753] (22 PDB entries) |
Domain d6x21a1: 6x21 A:239-348 [407294] Other proteins in same PDB: d6x21a2, d6x21b_ automated match to d5ufpa_ complexed with ukj |
PDB Entry: 6x21 (more details), 1.54 Å
SCOPe Domain Sequences for d6x21a1:
Sequence, based on SEQRES records: (download)
>d6x21a1 d.110.3.7 (A:239-348) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct kgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseie
>d6x21a1 d.110.3.7 (A:239-348) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct kgqvvsgqyrmlakhggyvwletqgtviypqcimcvnyvlseie
Timeline for d6x21a1: