Lineage for d6xawa_ (6xaw A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328543Fold a.59: PAH2 domain [47761] (1 superfamily)
    4 helices; open up-and-down bundle; binds alpha-helical peptides
  4. 2328544Superfamily a.59.1: PAH2 domain [47762] (1 family) (S)
  5. 2328545Family a.59.1.1: PAH2 domain [47763] (3 proteins)
  6. 2328559Protein automated matches [254596] (2 species)
    not a true protein
  7. 2328562Species Saccharomyces cerevisiae [TaxId:559292] [407281] (1 PDB entry)
  8. 2328563Domain d6xawa_: 6xaw A: [407282]
    automated match to d1s5qb_
    complexed with br

Details for d6xawa_

PDB Entry: 6xaw (more details), 1.84 Å

PDB Description: crystal structure analysis of sin3-ume6
PDB Compounds: (A:) Transcriptional regulatory protein SIN3

SCOPe Domain Sequences for d6xawa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xawa_ a.59.1.1 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
dvefsqaisyvnkiktrfadqpdiykhfleilqtyqreqkpinevyaqvthlfqnapdll
edfkkflpd

SCOPe Domain Coordinates for d6xawa_:

Click to download the PDB-style file with coordinates for d6xawa_.
(The format of our PDB-style files is described here.)

Timeline for d6xawa_: