SCOPe 2.08: Domain d6wnza_: 6wnz A:

Lineage for d6wnza_ (6wnz A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Saccharolobus solfataricus [TaxId:273057] [407223] (1 PDB entry)

8. Domain d6wnza_: 6wnz A: [407243]
   automated match to d2vl6a_
   complexed with zn

Details for d6wnza_

PDB Entry: 6wnz, 2 Å

PDB Description: structure of a dimer of the sulfolobus solfataricus mcm n-terminal domain reveals potential role in mcm ring opening

PDB Compounds: (A:) minichromosome maintenance protein mcm

SCOPe Domain Sequences for d6wnza_:

Sequence; same for both SEQRES and ATOM records:

>d6wnza_ b.40.4.0 (A:) automated matches {Saccharolobus solfataricus [TaxId: 273057]}
idyrdvfieflttfkgnnnqnkyierinelvayrkksliiefsdvlsfnenlayeiinnt
kiilpilegalydhilqldptyqrdiekvhvrivgiprvielrkirstdigklitidgil
vkvtpvkeriykatykhihpdcmqefewpedeempevlempticpkcgkpgqfrlipekt
klidwqkaviqerpeevpsgqlprqleiileddlvdsarpgdrvkvtgildikqdspvkr
gsravfdiymkvssievs

Timeline for d6wnza_:

• d6wnza_ first appeared in SCOPe 2.07