Lineage for d6wxli_ (6wxl I:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040904Species Influenza a virus (a/shanghai/js01/2013(h7n9)) [TaxId:1395980] [419796] (1 PDB entry)
  8. 3040907Domain d6wxli_: 6wxl I: [407236]
    Other proteins in same PDB: d6wxla_, d6wxlc_, d6wxle_, d6wxlg_, d6wxlj_, d6wxll_
    automated match to d4d00d_
    complexed with nag

Details for d6wxli_

PDB Entry: 6wxl (more details), 2.76 Å

PDB Description: cryo-em structure of the vrc315 clinical trial, vaccine-elicited, human antibody 1d12 in complex with an h7 sh13 ha trimer
PDB Compounds: (I:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6wxli_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wxli_ h.3.1.1 (I:) Influenza hemagglutinin (stalk) {Influenza a virus (a/shanghai/js01/2013(h7n9)) [TaxId: 1395980]}
gaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqf
elidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervk
rqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqi

SCOPe Domain Coordinates for d6wxli_:

Click to download the PDB-style file with coordinates for d6wxli_.
(The format of our PDB-style files is described here.)

Timeline for d6wxli_: