Lineage for d6wxlc_ (6wxl C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386035Species Influenza a virus (a/shanghai/js01/2013(h7n9)) [TaxId:1395980] [407212] (1 PDB entry)
  8. 2386037Domain d6wxlc_: 6wxl C: [407233]
    Other proteins in same PDB: d6wxlb_, d6wxld_, d6wxle_, d6wxli_, d6wxlj_, d6wxll_
    automated match to d4n62a_
    complexed with nag

Details for d6wxlc_

PDB Entry: 6wxl (more details), 2.76 Å

PDB Description: cryo-em structure of the vrc315 clinical trial, vaccine-elicited, human antibody 1d12 in complex with an h7 sh13 ha trimer
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6wxlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wxlc_ b.19.1.0 (C:) automated matches {Influenza a virus (a/shanghai/js01/2013(h7n9)) [TaxId: 1395980]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgsta
eqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpe

SCOPe Domain Coordinates for d6wxlc_:

Click to download the PDB-style file with coordinates for d6wxlc_.
(The format of our PDB-style files is described here.)

Timeline for d6wxlc_: