Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (57 species) not a true protein |
Species Influenza a virus (a/shanghai/js01/2013(h7n9)) [TaxId:1395980] [407212] (1 PDB entry) |
Domain d6wxlc_: 6wxl C: [407233] Other proteins in same PDB: d6wxlb_, d6wxld_, d6wxle_, d6wxli_, d6wxlj_, d6wxll_ automated match to d4n62a_ complexed with nag |
PDB Entry: 6wxl (more details), 2.76 Å
SCOPe Domain Sequences for d6wxlc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wxlc_ b.19.1.0 (C:) automated matches {Influenza a virus (a/shanghai/js01/2013(h7n9)) [TaxId: 1395980]} dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi rtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgsta eqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfng afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv kqrslllatgmknvpe
Timeline for d6wxlc_: